2006 Hyundai Tucson Owners Manual

2  DRIVINGYOURHYUNDAI
10
C090B02A-AAT
C090C01A-AAT
C090F01JM-GAT
The function of each position is as fol-
o R(Reverse):
Sports Mode
lows:
Use for backing up the vehicle. Bring the car to
a  complete  stop  before  shifting the  selector
lever to "R"  position.
o P (Park):
Use to hold the vehicle in place when parked or
while starting the engine. Whenever parking the
car, apply the parking brake and shift the selec-
tor lever to  the "P" (Park) position.
C090D02O-AAT
o  N (Neutral):
In the  "N" position, the transaxle  is in neutral,
which means that  no gears are engaged. The
engine can be started with the shift lever in "N"
position,  although  this  is  not  recommended
except  if  the  engine  stalls  while  the   car  is
moving.
!
Never  place  the selector  lever  in  the  "P"
(Park)  position unless  the  vehicle  is fully
stopped.  Failure  to  observe  this   caution
will cause severe  damage to the transaxle.
CAUTION:
HJM3020
Whether the vehicle is  stationary or in motion,
sports mode is selected by pushing the selector
lever from the "D" position into the manual gate.
To  return  to  "D"  range  operation,  push  the
selector lever back  into the main gate.
In sports mode, moving the selector lever back-
wardsandforwardscanmakegearshiftssimple.
UP (+) : Push the lever forward once to shift up
one gear.
C090E01O-AAT
o  D(Drive):
Use for normal driving. The transaxle will auto-
matically shift  through a four gear  sequence.
DOWN (-)  : Pull  the lever backwards  once to
shift down one  gear.
SKIP : By rapidly moving the selector forwards
or backwards  twice, it  is possible to  skip one
gear, i.e. 1st to  3rd or 3rd to 1st.
Product Specification
CategoriesHyundai Manuals, Hyundai Tucson Manuals
Tags,
Model Year2006
Download File
Please Enter the Security Characters Shown Below. Letters are Case Sensitive. Your download link will appear upon completing this step.
- 289 pages
Document TypeOwners Manual
LanguageEnglish
Product BrandHyundai, Tucson
Document File TypePDF
CopyrightAttribution Non-commercial
(15 votes, average: 3.73 out of 5)
Automotive readers have rated 2006 Hyundai Tucson Owners Manual 3.7 out of 5.0 based on 15 product reviews.
Submit your review (optional)
(will not be displayed)
* Required Field

2006 Hyundai Tucson Owners Manual SKU UPC Model
dsfsdf on Jun 08, 2015.

Para conocer mas sobre el automovil


mm on Feb 19, 2015. down

i dunnio if it is going to qwork or not etc


Jesus Salinas on Nov 10, 2014. manual

Para conocer mas sobre el automovil


sam jones on Dec 29, 2013.



herbert diaz zevallos on Feb 15, 2013.



Page:
12