2 DRIVINGYOURHYUNDAI
10
C090B02A-AAT
C090C01A-AAT
C090F01JM-GAT
The function of each position is as fol-
o R(Reverse):
Sports Mode
lows:
Use for backing up the vehicle. Bring the car to
a complete stop before shifting the selector
lever to "R" position.
o P (Park):
Use to hold the vehicle in place when parked or
while starting the engine. Whenever parking the
car, apply the parking brake and shift the selec-
tor lever to the "P" (Park) position.
C090D02O-AAT
o N (Neutral):
In the "N" position, the transaxle is in neutral,
which means that no gears are engaged. The
engine can be started with the shift lever in "N"
position, although this is not recommended
except if the engine stalls while the car is
moving.
!
Never place the selector lever in the "P"
(Park) position unless the vehicle is fully
stopped. Failure to observe this caution
will cause severe damage to the transaxle.
CAUTION:
HJM3020
Whether the vehicle is stationary or in motion,
sports mode is selected by pushing the selector
lever from the "D" position into the manual gate.
To return to "D" range operation, push the
selector lever back into the main gate.
In sports mode, moving the selector lever back-
wardsandforwardscanmakegearshiftssimple.
UP (+) : Push the lever forward once to shift up
one gear.
C090E01O-AAT
o D(Drive):
Use for normal driving. The transaxle will auto-
matically shift through a four gear sequence.
DOWN (-) : Pull the lever backwards once to
shift down one gear.
SKIP : By rapidly moving the selector forwards
or backwards twice, it is possible to skip one
gear, i.e. 1st to 3rd or 3rd to 1st.
| Categories | Hyundai Manuals, Hyundai Tucson Manuals |
|---|---|
| Tags | Hyundai Tucson 2.0, Hyundai Tucson 2.7 |
| Model Year | 2006 |
| Download File |
|
| Document Type | Owners Manual |
| Language | English |
| Product Brand | Hyundai, Tucson |
| Document File Type | |
| Copyright | Attribution Non-commercial |
(15 votes, average: 3.73 out of 5)
Automotive readers have rated 2006 Hyundai Tucson Owners Manual 3.7 out of 5.0 based on 15 product reviews. Wish it would ask this after download
have not found what I was looking for
need owners manual hope it works
I have a diesel Tucson. The word diesel never appears in this document.
could have better information for V6
Perfect I hope, it can be useful
want the required maintenance for the car
Like that I can find out what maintenance is required for my car
2006 Hyundai Tucson Owners Manual
I hope this will work. Need a manual.