DRIVINGYOURHYUNDAI2
7
NOTE:
Depress the brake pedal and push the
button when shifting.
C090C01A-AAT
o R(Reverse):
C090F01JM-GAT
Sports Mode
Use for backing up the vehicle. Bring the car to
a complete stop before shifting the selector
lever to "R" position.
Push the button when shifting.
The selector lever can be shifted freely.
The indicator lights in the instrument cluster
indicate the selector lever position when the
ignition is switched "ON". During "D" range
operation, green lights indicate the gear cur-
rently in use.
C090D02O-AAT
o N (Neutral):
In the "N" position, the transaxle is in neutral,
which means that no gears are engaged. The
engine can be started with the shift lever in "N"
position, although this is not recommended
except if the engine stalls while the car is
moving.
C090B02A-AAT
The function of each position is as fol-
lows:
C090F01O
Whether the vehicle is stationary or in motion,
sports mode is selected by pushing the selector
lever from the "D" position into the manual gate.
To return to "D" range operation, push the
selector lever back into the main gate.
In sports mode, moving the selector lever back-
wardsandforwardscanmakegearshiftssimple.
o P (Park):
C090E01O-AAT
o D(Drive):
Use to hold the vehicle in place when parked or
while starting the engine. Whenever parking the
car, apply the parking brake and shift the selec-
tor lever to the "P" (Park) position.
Use for normal driving. The transaxle will auto-
matically shift through a four gear sequence.
UP (+) : Push the lever forward once to shift up
one gear.
DOWN (-) : Pull the lever backwards once to
shift down one gear.
SKIP : By rapidly moving the selector forwards
or backwards twice, it is possible to skip one
gear, i.e. 1st to 3rd or 3rd to 1st.
!
Never place the selector lever in the "P"
(Park) position unless the vehicle is fully
stopped. Failure to observe this caution
will cause severe damage to the transaxle.
CAUTION:
| Categories | Hyundai Manuals, Hyundai Santa Fe Manuals |
|---|---|
| Tags | Hyundai Santa Fe 2.7, Hyundai Santa Fe 3.5 |
| Model Year | 2005 |
| Download File |
|
| Document Type | Owners Manual |
| Language | English |
| Product Brand | Hyundai, Santa Fe |
| Document File Type | |
| Copyright | Attribution Non-commercial |
(2 votes, average: 4.5 out of 5)
Automotive readers have rated 2005 Hyundai Santa Fe Owners Manual 4.5 out of 5.0 based on 2 product reviews. To Whom this concerns, I have purchased a 2005 santa fe 3.5 and it didn't come with a man. I was hoping you could send me one so I know how to operate some of these options, Thank You, Barry Galbraith
Comments are closed.